PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10010497m
Common NameCICLE_v10010497mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Nin-like
Protein Properties Length: 189aa    MW: 21226 Da    PI: 6.3858
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10010497mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK71.61.1e-22141188249
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRki 49 
                      + +++l dl  yF+lpi++AA+ +++c+Tv+K+iCR+ G++RWPhRk+
  Ciclev10010497m 141 TGKLTLRDLMIYFHLPIEEAARRMKLCPTVVKKICRRDGLHRWPHRKV 188
                      5689*******************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.585131188IPR003035RWP-RK domain
PfamPF020423.1E-19143188IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MADPRAIVPY HDPHDNSYTE DIFNFINNPN PTFADLSLFE EPSSIPHSTN NPQSGGIITD  60
AGDPFDDPLF WDIGNNCNAG SFQAGPSGNQ AEMSDRGTPA IENAANMKAF PRWPVPPEPY  120
LCSCCLVLRE IIHTNVQRER TGKLTLRDLM IYFHLPIEEA ARRMKLCPTV VKKICRRDGL  180
HRWPHRKV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5731490.0AB573149.1 Citrus unshiu genomic DNA, polyembryony locus, cultivar: Miyagawa wase.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006453027.11e-140hypothetical protein CICLE_v10010497mg
TrEMBLV4UJF11e-140V4UJF1_9R
STRINGPOPTR_0006s23960.12e-45(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40762342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.18e-10RWP-RK domain-containing protein